Allen B. Rawitch

Hog thyroid peroxidase: Physical, chemical, and catalytic properties of the highly purified enzyme

Abstract Studies are reported on the purity and on the physical, chemical, and catalytic properties of a highly purified, stable, thyroid peroxidase (TPO). The enzyme was solubilized by treatment with deoxycholate and trypsin, and it was purified by a series of column treatments, including ion-exchange chromatography on DEAE-cellulose, gel filtration through Bio-Gel P-100, and hydroxylapatite chromatography. The final product, designated TPO VII, had a value for A 410 /A 280 of 0.54, and its specific activity based on the guaiacol assay (794 μmol of guaiacol oxidized/min/mg) was considerably greater than that of any previously described TPO. Specific activity values based on other peroxidase-catalyzed reactions were also higher for TPO VII than for previous TPO preparations. Purity estimates for TPO VII, based on polyacrylamide disc gel electrophoresis and on isoelectric focusing in polyacrylamide gels, ranged from 80 to 95%. The molecular weight, determined by sedimentation equilibrium, was 93,000. Results of sodium dodecyl sulfate-gel electrophoresis also indicated a molecular weight of approximately 90,000. Sodium dodecyl sulfate-gel electrophoresis under reducing conditions indicated that TPO VII is composed of two peptide chains of unequal size, with the larger about 2.5-fold the size of the smaller. Carbohydrate analysis revealed that TPO is a glycoprotein containing about 10% by weight of carbohydrate. The predominant sugars were mannose and N -acetyl glucosamine. A significant amount of glucose was also found, along with small amounts of galactose, fucose, and xylose. The amino acid composition of TPO VII showed a high proline content, a predominance of arginine over lysine, and a ratio of [Asp] plus [Glu] to [Lys] plus [Arg] of over 2. Isoelectric focusing in polyacrylamide gels indicated an isoelectric pH of 5.75. In agreement with observations made on earlier preparations of TPO, heme spectral data showed significant differences between the pyridine hemochromogens of TPO VII and horseradish peroxidase, suggesting that the heme in TPO is not ferriprotoporphyrin IX. Circular dichroism measurements indicated that approximately 40% of TPO VII involves α helix or β structure.

Chronic administration of delta-9-tetrahydrocannabinol to pregnant rats: Studies of pup behavior and placental transfer

Tritiated delta-9-tetrahydrocannabinol was administered orally to female rats throughout pregnancy at a dose level of 2 mg/kg/day. Chemical analysis of rat pup tissues indicated an average drug level near 20 ng/gm was attained via placental transfer. Although there was no teratogenicity, the pups showed both transient and relatively permanent behavioral effects. A deficit in acquisition of a passive avoidance response at 21 days of age was observed. This effect was not apparent during retraining and testing at 90 days of age. Rats whose dams had received the drug forced control animals to back out of a push tube in 67% of the tests at 21 days of age and 94% of the tests at 90 days of age.

Isolation and structures of alligator gar (Lepisosteus spatula) insulin and pancreatic polypeptide

Insulin and a 36-residue peptide with homology to pancreatic polypeptide (PP) were isolated from the endocrine pancreas of the alligator gar (Lepisosteus spatula), a ganoid fish, by gel filtration and HPLC. Heterologous radioimmunoassays were used to detect insulin-like and PP-like immunoreactivities during purification of the two peptides. The sequence of the 36-amino acid peptide containing a C-terminal tyrosinamide was identical at 31 of 36 positions to porcine neuropeptide Y (NPY). The amino acid sequence of this peptide is YPPKPENPGEDAPPEELAKYYSALRHYINLITRQRY-NH2. The second peptide, gar insulin, contains 52 amino acid residues and is composed of a 21-residue A chain and a 31-residue B chain. The sequence of the A chain is GIVEQCCHKPCTIYELENYCN. The sequence of the B chain is AANQHLCGSHLVEALYLVCGEKGFFYNPNKV.

Antipeptide antibodies reveal structural and functional characteristics of rat placental lactogen-II☆☆☆

The purpose of this investigation was to develop specific immunologic probes to rat placental lactogen-II (PL-II) and to use the immunologic probes to further characterize rat PL-II. Five oligopeptides corresponding to different regions of rat PL-II (amino acids 1-13, 56-70, 89-103, 107-118, 150-164) were chemically synthesized by solid phase methods and purified to homogeneity by reverse phase high performance liquid chromatography. The synthetic peptides were coupled to keyhole limpet hemocyanin (KLH) and the peptide-KLH conjugates were used to immunize rabbits. Antibody production was monitored by enzyme-linked immunoassay (EIA), electrophoresis and immunoblotting analyses. Each of the antipeptide antisera showed reactivity with the entire rat PL-II protein; however, the extent of the reactivities of each antiserum with rat PL-II was dependent on the conformational state of rat PL-H. Antisera directed to amino acids 56-70 showed the best reactivity toward each of the conformational states of rat PL-II tested. Antibodies generated to the entire rat PL-II protein specifically recognized the 56-70 amino acid sequence but showed limited reactivity with synthetic peptide corresponding to amino acids 1-13, 89-103, 107-118, and 150-164 of rat PL-II. Antisera to amino acids 56-70 of rat PL-II were specific for PLs as demonstrated by their recognition of rat PL-II, mouse PL-II and human PL and by their lack of reactivity with rat pituitary prolactin and growth hormone and with a series of other synthetic peptides to rat PL-II and rat prolactin-like protein-A. The immunorecognition of human PL was restricted to antipeptide antibodies directed to amino acids 56-70 of rat PL-II. The chemically synthesized peptides representing various regions of rat PL-II did not show significant interactions with prolactin receptors, and antisera directed to the peptides failed to interfere with the binding of either rat PL-II or human PL to prolactin receptors. In summary, we have generated a series of immunologic probes for studying the structure of rat PL-II. The sequence comprising amino acids 56-70 of rat PL-II was shown to make up at least part of an epitope for rat PL-II and to be a region of significant structural homology with mouse PL-II and human PL.

The isolation of identical thyroxine containing amino acid sequences from bovine, ovine and porcine thyroglobulins.

Identical, thyroxine containing tryptic peptides have been isolated from digests of bovine, ovine and procine thyroglobulins. This 19 residue hormone containing sequence, NH2-Asn-Ile-Phe-Glu-T4-Gln-Val-Asp-Ala-Gln-Pro-Leu-Arg-Pro-Cys-Glu-Leu-G in-Arg- COOH, is completely conserved across these three species, and it represents a principal site of thyroxine synthesis. HPLC maps of tryptic digests of the thyroglobulins have been monitored at several wavelengths and suggest that, in each case, only a small number of tryptic peptides are iodinated in vivo and that an even smaller number of tryptic peptides contain thyroid hormone. These data are consistent with a high degree of selectivity in iodination of tyrosines within thyroglobulin and the subsequent coupling of these selected tyrosines to form thyroid hormone.

Isolation of alligator gar (Lepisosteus spatula) glucagon, oxyntomodulin, and glucagon-like peptide: amino acid sequences of oxyntomodulin and glucagon-like peptide

Oxyntomodulin, glucagon, and a glucagon-like peptide (GLP) have been isolated from the endocrine pancreas of the alligator gar (Lepisosteus spatula), a ganoid fish. The three peptides were isolated by gel filtration and HPLC and were identified by size, composition, and glucagon-like immunoreactivity. The amino acid sequences of the oxyntomodulin and GLP were determined. The oxyntomodulin contains 36 amino acid residues and its sequence is H S Q G T F T N D Y S K Y L D T R R A Q D F V Q W L M S T K R S G G I T. The composition of the glucagon is identical to the N-terminal 29 residues of the gar oxyntomodulin. The single form of GLP found contains 34 amino acid residues in the following sequence: H A D G T Y T S D V S S Y L Q D Q A A K K F V T W L K Q G Q D R R E. These findings suggest that all three peptides are derived from a common precursor.

The structure of a naturally occuring 10K polypeptide derived from the amino terminus of bovine thyroglobulin

A combination of data derived from peptide sequencing and nucleic acid sequencing of cloned cDNA fragments has been used to define the complete amino acid sequence of a 10,000 M.W., thyroxine containing polypeptide derived from bovine thyroglobulin. This fragment, TG-F, which was obtained following reduction and alkylation, has been placed at the amino terminus of the parent protein with hormone located at residue 5 in the primary sequence of the thyroglobulin molecule. The carboxyl terminal sequence of this fragment -Cys-Gln-Leu-Gln is found on the N-terminal side of a lys residue, suggesting that the peptide bond cleavage which occurs to produce this 80 residue fragment from the parent (330K) thyroglobulin chain is a gln-lys. In addition, the amino acid sequence of this 10K fragment contains: No sequence which would be a substrate for glycosylation and no carbohydrate. Several repeated homologous amino acid sequences. A striking number of beta-bends predicted from Chou-Fasman analyses, particularly near its carboxyl terminus.

A neuropeptide Y (NPY)-related peptide is present in the river lamprey CNS

Pancreatic polypeptide (PP)-like material from brain+spinal cord, and retina extracts of Lampetra fluviatilis was studied by HPLC and RIA. The brain+spinal cord extract showed a complex elution profile with multiple peaks of immunoreactivity. The retina extract showed a much simpler pattern with a single significant peak along with a trace of a second peak corresponding to the latest and penultimate peaks in the brain extract. Twenty-one out of 36 residues could be sequenced from the latest eluting peak in the brain extract. This sequence showed 81% identity with porcine neuropeptide (NPY) suggesting that both the brain/spinal cord and retina of the river lamprey contain a peptide homologous to NPY.

Differences in iodinated peptides and thyroid hormone formation after chemical and thyroid peroxidase-catalyzed iodination of human thyroglobulin

The distribution of iodine among the polypeptides of human goiter thyroglobulin (Tg) was examined. Tg was iodinated in vitro with 131I to levels of 2 to 84 gram atoms (g.a.)/mol using thyroid peroxidase (TPO) or a chemical iodination system. The samples were reduced, alkylated, and subjected to sodium dodecyl sulfate-polyacrylamide gel electrophoresis. Two low-molecular-weight peptides appeared preferentially in radioautograms of the sodium dodecyl sulfate (SDS) gels of TPO-iodinated samples. Iodination of these peptides increased sharply in the TPO-treated Tg as the level of total iodine/molecule rose. Radioiodine was incorporated into these same gel regions in the chemically treated Tg, but only after much higher levels of total iodination were reached. Differences in iodoamino acid distribution were also noted between the chemically and enzymatically iodinated thyroglobulins. In the chemically iodinated samples, little thyroxine (T4) was synthesized, even at high iodine levels. In the TPO-treated samples only small amounts of T4 were seen below 14 g.a. total I/mol, while at or above that level of iodination T4 formation increased sharply. To examine the coupling process, Tg was chemically iodinated, excess I- removed, and the samples treated with TPO and a H2O2-generating system in the absence of iodide. Radioautograms obtained from SDS-polyacrylamide gels of reduced and alkylated protein from such coupling assays showed an increase in the level of iodine in the low-molecular-weight peptides after TPO treatment. Thyroxine production also increased with TPO treatment. The addition of free DIT (a known coupling enhancer) to the [131I]Tg/TPO incubation increased both the production of T4 and the amount of iodine in the smaller polypeptides. Two-dimensional maps prepared from CNBr-digested TG showed differences between the coupled and uncoupled samples. Our observations confirm the importance of the low-molecular-weight peptides derived from Tg in thyroid hormone synthesis. At total iodine levels above 14 g.a./mol Tg in enzymatically treated samples there is selective incorporation of iodine into both the low-molecular-weight polypeptides and into thyroid hormone.

delta-9-Tetrahydrocannabinol uptake by adipose tissue: preferential accumulation in gonadal fat organs.

Abstract 1. Single doses of an aqueous suspension of [14C]-Δ9-tetrahydrocannabinol (Δ9-THC) were administered by intraperitoneal injection to groups of male and female CBA strain mice. 2. Experimental groups were sacrificed from 2 min to 6 hr following injection, and levels of Δ9-THC and its more polar metabolites determined in several tissues. 3. High levels of Δ9-THC were found in several fat bodies, along with liver and lung. Moreover, there was a large difference in the levels of cannabinoid accumulation in the fat organs studied, with significantly higher concentrations as well as absolute amounts of cannabinoid being found in gonadal fat. 4. The high Δ9-THC concentrations persisted in fat over several hours without significant metabolism, while in liver, lung and several other tissues, the level of Δ9-THC declined as substantial metabolism occurred during the same period. 5. The relative levels of cannabinoid found in various tissues were also examined after intravenous administration of the drug and a differential uptake of Δ9-THC and its metabolites by gonadal fat was again observed.