José Tadeu Abreu Oliveira

Proline accumulation and glutamine synthetase activity are increased by salt-induced proteolysis in cashew leaves

In this study cashew (Anacardium occidentale) plants were exposed to a short- and long-term exposure to NaCl in order to establish the importance of the salt-induced proteolysis and the glutamine synthetase activity on the proline accumulation. The cashew leaf showed a prominent proline accumulation in response to salt stress. In contrast, the root tissue had no significant changes in proline content even after the drastic injury caused by salinity on the whole plant. The leaf proline accumulation was correlated to protease activity, accumulation of free amino acid and ammonia, and decrease of both total protein and chlorophyll contents. The leaf GS activity was increased by the salt stress whereas in the roots it was slightly lowered. Although the several amino acids in the soluble pool of leaf tissue have showed an intense increment in its concentrations in the salt-treated plants, proline was the unique to show a proportional increment from 50 to 100 mol m-3 NaCl exposure (16.37 to 34.35 mmol kg-1 DM, respectively). Although the leaf glutamate concentration increased in the leaves of the salt-stressed cashew plants, as compared to control, its relative contribution to the total amino acid decreased significantly in stressed leaves when compared to other amino acids. In addition, when the leaf discs were incubated with NaCl in the presence of exogenous precursors (Glu, Gln, Orn or Arg) involved in the proline synthesis pathways, the glutamate was unique in inducing a significant enhancement of the proline accumulation compared to those discs with precursor in the absence of NaCl. These results, together with the salt-induced increase in the GS activity, suggest an increase in the de novo synthesis of proline probably associated with the increase of the concentration of glutamate. Moreover, the prominent salt-induced proline accumulation in the leaves was associated with the higher salt-sensitivity in terms of proteolysis and salt-induced senescence as compared to the roots. In conclusion, the leaf-proline accumulation was due, at least in part, to the increase in the salt-induced proteolysis associated with the increments in the GS activity and hence the increase in the concentration of glutamate precursor in the soluble amino acid pool.

Salinity-induced effects on nitrogen assimilation related to growth in cowpea plants

Abstract This study was carried out to establish relationships between nitrate and ammonia assimilation and growth of cowpea (Vigna unguiculata (L.) Walp) plants when exposed to NaCl-salinity. Cowpea plants were initially pre-acclimated under a mild NaCl-stress (50 mol m−3) during 8 days in order to induce salt acclimation. Subsequently, pre-acclimated and non-acclimated plants received a NaCl-osmotic shock (100 mol m−3) in the nutrient solution for 4 days. Although pre-acclimated plants exhibited lower NO3− uptake rate, in situ nitrate reduction, nitrate reductase (NR) activity, and shoot growth, they did not show alterations in these parameters, expressed as % of control, during the time-course experiment. These data suggest a salt adaptative response to a mild NaCl-salt stress. In contrast, addition of high level of NaCl (100 mol m−3) induced a steady decrease in nitrate uptake and assimilation parallel to a reduction in the shoot growth, particularly when the salt-shock was applied on the non-acclimated plants. On the other hand, the leaf glutamine synthetase activity, free amino acids and proline concentration showed a slight increase in all of salt treatments. The leaf soluble protein was slightly reduced by salt treatments during the short-term exposure. Moreover, the plants pre-acclimated with NaCl exhibited lower concentrations of protein and amino acids when compared with non-acclimated plants. Our study indicates that the regulation processes of N acquisition and growth of cowpea plants do operate at the whole plant level resulting in N homeostasis, especially in plants exposed to a mild-salt stress. Furthermore, the nitrate uptake and leaf-NR activity are more limiting for shoot growth than the primary ammonia assimilation from the glutamine synthetase.

Compositional and nutritional attributes of seeds from the multiple purpose tree Moringa oleifera Lamarck

Moringa oleifera Lam is a multipurpose tree cultivated to use as a vegetable, for spice, for cooking and cosmetic oil and as a medicinal plant. Owing to the use of its seeds as food and as a clarifying agent of turbid water some nutritional and antinutritional characteristics were studied. The mature seeds contained 332.5 g crude protein, 412.0 g crude fat, 211.2 g carbohydrate and 44.3 g ash per kg dry matter. The essential amino acid profile compared with the FAO/WHO/UNU scoring pattern requirements for different age groups showed deficiency of lysine, threonine and valine. The content of methionine + cysteine (43.6 g kg−1 protein), however, was exceptionally higher and close to that of human milk, chicken egg and cows milk. The seed extract agglutinated rabbit erythrocytes but did not show trypsin inhibitor and urease activities. Feeding rats with a diet containing the seed meal showed loss of appetite, impaired growth, lower NPU and enlargement of stomach, small intestine, caecum + colon, liver, pancreas, kidneys, heart and lungs and atrophy of thymus and spleen in comparison with rats fed on an egg-white diet. The results indicated that consumption of M oleifera raw mature seeds should be viewed with some caution until suitable processing methods are developed to abolish the yet unknown adverse factors.

Composition, toxic and antinutritional factors of newly developed cultivars of Brazilian soybean (Glycine max)

Five different recently released Brazilian soybean cultivars (Bays, BR-10, Rio Balsas, Serido and Tropical) were compared for their proximate analyses and presence of antinutritional or toxic factors. As expected, the seeds are rich in proteins, varying from 360·7 to 485·4 g kg−1 flour, and they also have a high amount of fat (from 183·0 to 215·3 g kg−1 flour). Crude extracts from seeds of Bays, BR-10, Serido and Tropical were highly toxic to mice within 1–12 h, depending on the administration route (intraperitoneal, intramuscular or subcutaneous) and dose used while Rio Balsas was not. These acute effects were very similar to those produced by the soytoxin, a neurotoxin that has been recently purified from the commercial soybean sold in Brazil. The amount of trypsin inhibited in the presence of crude extracts ranged from 28·5 to 62·5 g kg−1 flour. Urease was also present and the seed lectin agglutinated preferentially rabbit erythrocytes. A heat treatment at 92°C for 1 min destroyed completely the toxic activity while the haemagglutinating and trypsin inhibitor activities were abolished within 5 min. At these conditions urease was still active. Due to its high protein content, lack of soytoxin, and low levels of trypsin inhibitor, lectin, and urease it is suggested that Rio Balsas could be an alternative for breeding programmes aimed to improve the nutritional quality of soybeans. ©1997 SCI

Rat paw edema and leukocyte immigration induced by plant lectins

Lectins fromDioclea grandiflora (DG) andCanavalia brasiliensis (CB) were compared with Concanavalin A (ConA) for their ability to induce paw edema and peritoneal cell immigration in rats. ConA caused a slight edema with a peak at 1 h after injection, while DG or CB induced a pronounced and long-lasting edema that reached a maximum at about 6 h. Different antiinflammatory drugs partially inhibited the edema. α-d-glucose (GLU) partially blocked the edema caused by ConA and markedly inhibited that due to CB, but had no effect on the edema induced by DG. α-Methyl mannoside (α-MM) blocked the edema caused by DG and ConA, but did not affect that caused by CB. At doses much lower than those used to induce paw edema, the lectins promoted an intense accumulation of neutrophil and mononuclear cells in the rat peritoneal cavity. CB and DG were more potent than ConA, which also presented a different profile of cell immigration. GLU significantly inhibited leukocyte accumulation caused by all lectins. α-MM impaired ConA- and DG-induced cell immigration, but only partially inhibited CB. Thus, despite their physicochemical similarities with ConA, DG and CB have more powerful pro-inflammatory effects. This difference seems to be related to their sugar-binding properties. However, while ConA- and DG-induced effects were inhibited more by α-MM than by GLU, CB-induced effects were inhibited more by glucose.

Proteomic analysis of the reproductive tract fluids from tropically-adapted Santa Ines rams ☆

The present study is focused on the proteome of reproductive tract fluids from tropically-adapted Santa Ines rams. Seminal plasma, cauda epididymal (CEF) and vesicular gland fluid (VGF) proteins were analyzed by 2-D electrophoresis and mass spectrometry. Seminal plasma maps contained 302 ± 16 spots, within the 4-7 pH range. From these maps, 73 spots were identified, corresponding to 41 proteins. Ram Seminal Vesicle Proteins (RSVP) 14 and 22kDa and bodhesins 1 and 2 represented the most abundant seminal components. Other seminal proteins included clusterin, angiotensin-converting enzyme, matrix metalloproteinase-2, tissue-inhibitor of metalloproteinase-2, plasma glutamate carboxypeptidase, albumin, lactoferrin, alpha enolase, peroxiredoxin, leucine aminopeptidase, β-galactosidase, among others. Later, seminal plasma gels were run within narrow pH intervals (3.9-5.1; 4.7-5.9; 5.5-6.7), allowing the additional identification of 21 proteins not detected in 4-7 pH maps. Major proteins of CEF and VGF were albumin and transferrin, and RSVPs, respectively. Western blots confirmed that RSVPs were mainly present in VGF while bodhesins, in VGF and CEF. Based on RT-PCR, RSVP and bodhesin genes were primarily expressed in the vesicular glands. In summary, the reproductive tract fluids of Brazilian hairy rams contain several categories of proteins, with potential roles in sperm protection, capacitation, acrosome reaction and sperm-oocyte interaction.

Plant lectins, chemical and biological aspects

Lectins, carbohydrate-binding proteins of non-immune origin, that agglutinate cells or precipitate polysaccharides and glycoconjugates, are well distributed in nature, mainly in the Plant Kingdom. The great majority of the plant lectins are present in seed cotyledons where they are found in the cytoplasm or in the protein bodies, although they have also been found in roots, stems and leaves. Due to their peculiar properties, the lectins are used as a tool both for analytical and preparative purposes in biochemistry, cellular biology, immunology and related areas. In agriculture and medicine the use of lectins greatly improved in the last few years. The lectins, with few exceptions, are glycoproteins, need divalent cations to display full activity and are, in general, oligomers with variable molecular weight. Although the studies on lectins have completed a century, their role in nature is yet unknown. Several hypotheses on their physiological functions have been suggested. Thus, lectins could play important roles in defense against pathogens, plant-microorganism symbiosis, cell organization, embryo morphogenesis, phagocytosis, cell wall elongation, pollen recognition and as reserve proteins. A brief review on the general properties and roles of the lectins is given.

Composition and nutritional properties of seeds from Pachira aquatica Aubl, Sterculia striata St Hil et Naud and Terminalia catappa Linn.

Abstract The seeds of three wild plants (Pachira aquatica, Sterculia striata and Terminalia catappa) were analyzed to establish their chemical compositions and nutritional properties in order to investigate the possibility of using them for human and/or animal consumption. Proximate analyses showed that they have high amounts of protein and oil. However, they are deficient in various essential amino acids but P. aquatica seeds have tryptophan, threonine and phenylalanine + tyrosine contents higher than those reported for human milk, chicken egg and cows milk. Haemagglutinating and trypsin inhibitor activities were found to be present in the seeds of P. aquatica and T. catappa but absent in S. striata. Coincidentally the rats fed on S. striata diet gained slightly in weight and presented alterations in the key internal organs which were less drastic throughout the 10-day test period. On the other hand, the rats fed on T. catappa diet maintained their body weight but suffered from stomah, small intestine and pancreas hypertrophy as well as spleen atrophy. Five out of six rats fed on P. aquatica diet died within 6–8 days. The remaining rat experienced enlargement of the stomach, liver, pancreas, kidneys, heart and lungs and had spleen atrophy when compared with the same organs of rats fed on egg-white diet. Hypertrophy of the pancreas and kidneys was very marked and these organs nearly doubled in dry weight in comparison with those of the egg-white control group, demonstrating that the raw seed of P. aquatica are highly toxic when fed to rats even at a meal protein concentration half that of S. striata or T. catappa, which were better tolerated by the experimental animals.

Nutritional study of two Brazilian soybean (Glycine max) cultivars differing in the contents of antinutritional and toxic proteins

The research was conducted with two different recently released Brazilian soybean cultivars (Rio Balsas and Bays) to evaluate whether there is any correlation between the different levels of antinutritional and/or toxic proteins in the cultivars and their nutritive value as sources of protein for monogastric animals (rats). Furthermore, it is discussed, for the first time, the role of the dietary soyatoxin on the performance of rats fed on diets containing soyatoxin-rich (cv. Bays) and soyatoxin-free (cv. Rio Balsas) soybean cultivars. Feeding rats with diets containing raw soybean cultivars showed a lower growth rate, net protein utilization and digestibility, a much higher dry matter and nitrogen excretion and macroscopic alterations in internal organs when compared to rats fed on egg-white protein. The nutritional parameters measured for the diet based on raw Bays cultivar were poorer than those of the diet prepared with Rio Balsas. In the raw soybeans, trypsin inhibitor and lectin, and urease to a lesser extent, significantly affected at different fashion the soybean protein utilization. Heating treatment of the Bays seeds increased the growth rate, NPU, in vivo protein digestibility and practically eliminated or attenuated all the organ alterations observed. This study might be helpful in the choice of safe and nutritious soybean cultivars.

Osmotin purified from the latex of Calotropis procera: biochemical characterization, biological activity and role in plant defense.

A protein, similar to osmotin- and thaumatin-like proteins, was purified from Calotropis procera (Ait.) R.Br latex. The isolation procedure required two cation exchange chromatography steps on 50mM Na-acetate buffer (pH 5.0) CM-Sepharose Fast Flow and 25 mM Na-phosphate buffer (pH 6.0) Resource-S, respectively. The protein purity was confirmed by an unique N-terminal sequence [ATFTIRNNCPYTIWAAAVPGGGRRLNSGGTWTINVAPGTA]. The osmotin (CpOsm) appeared as a single band (20,100 Da) in sodium dodecyl sulfate-polyacrylamide gel electrophoresis and as two spots in two-dimensional electrophoresis (pI 8.9 and 9.1). Both polypeptides were further identified by mass spectrometry as two osmotin isoforms with molecular masses of 22,340 and 22,536 Da. The CpOsm exerted antifungal activity against Fusarium solani (IC₅₀=67.0 μg mL⁻¹), Neurospora sp. (IC₅₀=57.5 μg mL⁻¹) and Colletotrichum gloeosporioides (IC₅₀=32.1 μg mL⁻¹). However, this activity was lost when the protein was previously treated with a reducing agent (DTT, Dithiothreitol) suggesting the presence of disulfide bounds stabilizing the protein. The occurrence of osmotin in latex substantiates the defensive role of these fluids.