Liyan Song
Jinan University
Network
Latest external collaboration on country level. Dive into details by clicking on the dots.
Publication
Featured researches published by Liyan Song.
Journal of Agricultural and Food Chemistry | 2014
Yongshuai Jing; Lijiao Huang; Wenjie Lv; Hui Tong; Liyan Song; Xuqiao Hu; Rongmin Yu
A novel polysaccharide (LCP50W) with a molecular weight of 4.72 × 10(4) Da was isolated from the pulp tissues of Litchi chinensis . The chemical structure of LCP50W was characterized using physicochemical and instrumental analyses. The results indicated that the main chain of LCP50W consisted of (1→3)-linked β-L-rhamnopyranosyl, (1→6)-linked α-D-glucopyranosyl, and (1→2,6)-linked α-D-glucopyranosyl residues, which branched at O-6. The three branches consisted of (1→2)-linked α-L-rhamnopyranosyl, (1→3)-linked α-D-galactopyranosyl, and (1→3)-linked α-L-mannopyranosyl residues, terminated with (1→)-linked α-L-arabinopyranosyl residues, respectively. The in vitro immunomodulatory assay revealed that LCP50W promoted the proliferation of mouse splenocytes and enhanced the cytotoxicity of NK cells. LCP50W boosted the secretion of Th1 cytokine IFN-γ while it inhibited the secretion of Th2 cytokine IL-4; it also enhanced the expression of T-bet while it inhibited the expression of GATA-3. Additionally, LCP50W promoted the development of cell cycle toward the S phase.
Journal of Agricultural and Food Chemistry | 2015
Yongshuai Jing; Jianhua Zhu; Ting Liu; Sixue Bi; Xianjing Hu; Zhiyan Chen; Liyan Song; Wenjie Lv; Rongmin Yu
A novel polysaccharide (CMPA90-1; compound 1) was isolated from the cultured fruiting bodies of Cordyceps militaris. The chemical structure of compound 1 was elucidated by acid hydrolysis, periodate oxidation, Smith degradation, and methylation analysis, along with Fourier transform infrared spectroscopy, high-performance anion-exchange chromatography coupled with pulsed amperometric detection, gas chromatography-mass spectrometry, and one-dimensional [(1)H and (13)C nuclear magnetic resonance (NMR)] and two-dimensional NMR (heteronuclear single-quantum coherence and heteronuclear multiple-bond correlation). Sulfation of compound 1 by the chlorosulfonic acid-pyridine (CSA-Pyr) method led to synthesis of its sulfated analogue (CMPA90-M1; compound 2). The ultrastructures of both compounds 1 and 2 were further characterized by scanning electron microscopy and atomic force microscopy. The results of antioxidant assays showed that compounds 1 and 2 exhibited free-radical-scavenging effects, ferrous-ion-chelating ability, and reducing power. Also, in the cytotoxicity assay, compounds 1 and 2 showed inhibitory activity against A549 cells, with IC50 values of 39.08 and 17.33 μg/mL, respectively.
Journal of Agricultural and Food Chemistry | 2011
Xuqiao Hu; Yuan-Yuan Huang; Quanfeng Dong; Liyan Song; Fei Yuan; Rongmin Yu
A novel polysaccharide (LCP50S-2) with antioxidant activity was isolated from Litchi chinensis Sonn. The structure of LCP50S-2 was elucidated on the basis of physicochemical and instrumental analyses, and its average molecular weight was determined by gel permeation chromatography to be 2.19 × 10(2) kDa. The backbone of LCP50S-2 was composed of (1→3)-linked β-L-rhamnopyranosyl residues, (1→4)-linked α-D-xylopyranosyl residues, (1→4)-linked β-D-glucopyranosyl residues, and (1→4)-linked α-D-glucopyranosyl residues which branched at O-6. The two branches consisted of α-L-arabinopyranosyl residues and (1→6)-linked β-D-galactopyranosyl residues terminated with α-L-arabinopyranosyl residues, respectively. In the in vitro antioxidant assay, LCP50S-2 was found to possess DPPH radical-scavenging activity and hydroxyl radical-scavenging activity with IC(50) values of 220 and 266 μg/mL, respectively.
International Journal of Biological Macromolecules | 2010
Fei Yuan; Rongmin Yu; Yin Yin; Jianru Shen; Quanfeng Dong; Ling Zhong; Liyan Song
A novel polysaccharide (GBP50S2) with antioxidant activity was isolated from Ginkgo biloba. The structure of GBP50S2 was elucidated on the basis of physico-chemical and instrumental analyses, and its average molecular weight (Mw=2.30x10(5)) was determined by gel permeation chromatography. The backbone of GBP50S2 was composed of (1-->4)-linked alpha-d-mannopyranosyl residues which branched at O-3. The three branches consisted of beta-l-rhamnopyranosyl residues, (1-->4)-linked alpha-d-galactopyranosyl terminated with beta-l-rhamnopyranosyl residues, and (1-->3,4)-linked alpha-d-mannopyranosyl terminated with beta-l-rhamnopyranosyl residues, respectively. In the in vitro antioxidant assay, GBP50S2 was found to possess DPPH radical-scavenging activity and hydroxyl radical-scavenging activity with an IC(50) value of 0.412 mg/mL and 0.482 mg/mL, respectively.
Marine Drugs | 2008
Liyan Song; Tingfei Li; Rongmin Yu; Chunyan Yan; Shengfang Ren; Yu-qian Zhao
In order to get products with antioxidant activity from Arca subcrenata Lischke, the optimal hydrolase and hydrolysis conditions were investigated in the paper. Three proteases (neutrase, alcalase and papain) were applied to hydrolyze the homogenate of A. subcrenata. An orthogonal design was used to optimize hydrolysis conditions, and the pH-stat methods was used to determine the degree of hydrolysis. Viewed from the angle of reducing power, such as scavenging activities against α,α-diphenyl-β-picrylhydrazyl (DPPH) radical and hydrogen peroxide, the antioxidant activities of the alcalase hydrolysate (AH) were superior to neutrase hydrolysate (NH) and papain hydrolysate (PH), and its EC50 values in DPPH radical and hydrogen peroxide scavenging effect were 6.23 mg/ml and 19.09 mg/ml, respectively. Moreover, compared with products hydrolyzed by neutrase and papain, the molecular mass of AH was lower and its content of amino acid of peptides was higher. Therefore, alcalase was selected as the optimal enzyme to produce active ingredients since its hydrolysate exhibited the best antioxidant activity among them and possessed large amount of potential active peptides.
Carbohydrate Polymers | 2014
Yongshuai Jing; Xinlu Cui; Zhiyan Chen; Lijiao Huang; Liyan Song; Ting Liu; Wenjie Lv; Rongmin Yu
A novel low-molecular-weight polysaccharide (CMP-1) with antioxidant, immunostimulatory and antitumor activities was isolated from the cultured Cordyceps militaris. The structure of CMP-1 was elucidated by a combination of physicochemical and instrumental analyses, and its average molecular weight was 4.3 kDa. The backbone of CMP-1 was composed of (1 → 4)-linked α-D-glucopyranosyl, (1 → 6)-linked β-D-glucopyranosyl and (1 → 4)-linked β-D-glucopyranosyl residues which branched at O-6. The branches consisted of (1 → 3)-linked α-L-rhamnopyranosyl terminated with (1 → )-linked α-D-glucopyranosyl residues. The ultrastructure of CMP-1 was further investigated by scanning electron microscope (SEM). The antioxidant assays showed that CMP-1 exhibited free radical-scavenging effects, ferrous ions-chelating ability and reducing power. In vitro test revealed that CMP-1 could significantly stimulate the mouse splenocyte proliferation. The cytotoxicity assay showed that CMP-1 inhibited the proliferation of HT-29, HeLa, HepG2 and K562 cells, with the IC50 values of 137.66, 162.59, 176.29 and 364.01 μg/mL, respectively.
Marine Drugs | 2008
Liyan Song; Shengfang Ren; Rongmin Yu; Chunyan Yan; Tingfei Li; Yu-Ting Zhao
Two purified proteins G-6 and G-4-2 were obtained from Arca subcrenata Lischke using the homogenization, salting-out with ammonium sulfate, ion-exchange chromatography and gel filtration chromatography techniques. The purity of G-6 and G-4-2 was over 96%, as measured by RP-HPLC. G-6 and G-4-2 were measured by SDS-PAGE and IEF-PAGE to have molecular weights of 8.2 kDa and 16.0 kDa, and isoelectric points of 6.6 and 6.1, respectively. The amino acid constituents of G-6 and G-4-2 were also determined. The existence of saccharides in G-6 was demonstrated by the phenol-sulfuric acid method. G-6 and G-4-2 inhibited the proliferation of human tumor cells in vitro. By MTT assay, the IC50 values of G-4-2 were 22.9 μg/mL, 46.1 μg/mL and 57.7 μg/mL against Hela, HL-60 and KB cell lines, respectively, and the IC50 value of G-6 against HL-60 cell line was measured to be 123.2 μg/mL.
Carbohydrate Polymers | 2016
Wensong Tu; Jianhua Zhu; Sixue Bi; Dehong Chen; Liyan Song; Lishan Wang; Jiachen Zi; Rongmin Yu
A new water-soluble polysaccharide, designated as ASPW80-1, was first isolated from the fruit pulp of Annona squamosa. The structure of ASPW80-1 was elucidated based on the physicochemical and instrumental analyses. The results indicated that ASPW80-1 was a homogeneous heteropolysaccharide with an average molecular weight of 2.29×10(5)Da. Another novel modified polysaccharide, the sulfated derivative of ASPW80-1 namely as ASPW80-M1, was also synthesized. The ultra-structures of both ASPW80-1 and ASPW80-M1 were further characterized by scanning electron microscopy and atomic force microscopy. The antioxidant assays showed that ASPW80-1 and ASPW80-M1 exhibited DPPH and hydroxyl radicals scavenging activities. The results of immunomodulatory assays in vitro showed that ASPW80-1 and ASPW80-M1 could markedly promote the proliferation of mouse splenocytes. These results proposed that ASPW80-M1 might be proposed to be developed as a potential value-added product with the activities of immunomodulator and free-radical inhibitors.
Marine Drugs | 2013
Lili Chen; Liyan Song; Tingfei Li; Jianhua Zhu; Jian Xu; Qin Zheng; Rongmin Yu
A new antitumor and antioxidant peptide (H3) was isolated from Arca subcrenata Lischke using ion exchange and hydrophobic column chromatography. The purity of H3 was over 99.3% in reversed phase-high performance liquid chromatography (RP-HPLC) and the molecular weight was determined to be 20,491.0 Da by electrospray-ionization mass spectrometry (ESI-MS/MS). The isoelectric point of H3 was measured to be 6.65 by isoelectric focusing-polyacrylamide gel electrophoresis. Partial amino acid sequence of this peptide was determined as ISMEDVEESRKNGMHSIDVNHDGKHRAYWADNTYLM-KCMDLPYDVLDTGGKDRSSDKNTDLVDLFELDMVPDRKNNECMNMIMDVIDTN-TAARPYYCSLDVNHDGAGLSMEDVEEDK via MALDI-TOF/TOF-MS and de novo sequencing. The in vitro antitumor activity of H3 was evaluated by 3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium bromide (MTT) assay. The result indicated that H3 exhibited significant antiproliferative activity against HeLa, HepG2 and HT-29 cell lines with IC50 values of 10.8, 10.1 and 10.5 μg/mL. The scavenging percentage of H3 at 8 mg/mL to 2,2-diphenyl-1-picrylhydrazyl (DPPH) and hydroxyl radicals were 56.8% and 47.5%, respectively.
Marine Drugs | 2012
Xianjing Hu; Liyan Song; Lijiao Huang; Qin Zheng; Rongmin Yu
Arca subcrenata Lischke is a marine traditional Chinese medicine. The study investigated the antitumor effects of P2, a polypeptide fraction from A. subcrenata, and its toxicity in vitro and in vivo. The results showed that P2 could inhibit the proliferation of seven tumor cell lines, especially in HeLa and HT-29 cell lines. The IC50 values were 11.43 μg/mL for HeLa and 13.00 μg/mL for HT-29 treated by P2 for 48 h. P2 had little cytotoxicity on normal liver cells (L-02). The maximum tolerated dose (MTD) of P2 on KM mice was 1000 mg/kg by i.p. or i.v. The tumor growth inhibitory ratios of P2 were 26.4%, 41.4% and 46.4% for H-22, and 34.0%, 45.8% and 60.1% for S-180 tumor-bearing mice. The results demonstrated that P2 might be a potential antitumor agent with high efficiency in dose-dependent and time-dependent manners and low toxicity.